Antibodies

View as table Download

Rabbit anti-CBX5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBX5

Rabbit Polyclonal HP1alpha/beta/gamma Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HP1.,.,. antibody: human HP1 . (Heterochromatin protein 1 homolog beta), using the full length recombinant GST tagged protein. The antibody also recognizes the . and . isoforms.

Rabbit Polyclonal HP1alpha Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HP1. antibody: human HP1. (Heterochromatin protein 1 homolog alpha), using the full length recombinant GST tagged protein.

Rabbit Polyclonal Anti-CBX5 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE

HP1 alpha/CBX5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).
Modifications Unmodified

HP1 alpha Mouse monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HP1 alpha Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HP1 alpha