Antibodies

Jump to Filters
View as table Download
TIF1 gamma (TRIM33) Rabbit Polyclonal Antibody
TA345182

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-TRIM33 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33. Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
TIF1 gamma (TRIM33) Rabbit Polyclonal Antibody
TA319933

USD 430.00

5 Days

Rabbit Polyclonal TRIM33 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRIM33 antibody was raised against an 18 amino acid peptide near the center of human TRIM33.