Antibodies

View as table Download

Rabbit Polyclonal p53R2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

Rabbit Polyclonal GSTP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1.

Rabbit Polyclonal antibody to GSTA2 (glutathione S-transferase alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 196 of GSTA2 (Uniprot ID#P09210)

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

Rabbit polyclonal GCLM Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM.

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211)

Rabbit polyclonal GSTP1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1.

RRM2 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RRM2

Rabbit Polyclonal IDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human IDH2 protein (between residues 375-452) [UniProt P48735].

Rabbit Polyclonal Anti-GSR Antibody

Applications IF, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 1A7 (formerly 1A7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 5F9 (formerly 5F9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Anti-ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated