Rabbit Polyclonal p53R2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 . |
Rabbit Polyclonal p53R2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 . |
Rabbit Polyclonal GSTP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1. |
Rabbit Polyclonal antibody to GSTA2 (glutathione S-transferase alpha 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 196 of GSTA2 (Uniprot ID#P09210) |
Rabbit polyclonal antibody to GSTA1 (glutathione S-transferase A1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal IDH2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2. |
Rabbit polyclonal GCLM Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM. |
Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209) |
Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211) |
Rabbit polyclonal GSTP1 Antibody (C-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1. |
RRM2 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RRM2 |
Rabbit Polyclonal IDH2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human IDH2 protein (between residues 375-452) [UniProt P48735]. |
Rabbit Polyclonal Anti-GSR Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 1A7 (formerly 1A7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 5F9 (formerly 5F9)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 159.00
In Stock
Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 159.00
In Stock
ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 159.00
2 Days
Anti-ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
GSTT2 (Glutathione S Transferase theta 2) mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |