Antibodies

Jump to Filters
View as table Download
Frizzled 2 (FZD2) Goat Polyclonal Antibody
AP22449PU-N

USD 375.00

5 Days

Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001457.1.
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA313900

USD 345.00

In Stock

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.
Frizzled 9 (FZD9) Rabbit Polyclonal Antibody
TA314730

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.
Endothelin B Receptor (EDNRB) Rabbit Polyclonal Antibody
TA590006

USD 409.00

In Stock

Rabbit Polyclonal Endothelin B Receptor Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA311714

USD 345.00

In Stock

Rabbit polyclonal anti-FZD5 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
MC1 Receptor (MC1R) Rabbit Polyclonal Antibody
TA311992

USD 345.00

4 Weeks

Rabbit polyclonal anti-MSHR antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MSHR.
FZD3 Rabbit Polyclonal Antibody
TA314709

USD 345.00

In Stock

Rabbit polyclonal anti-FZD3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD3.
MC1 Receptor (MC1R) Rabbit Polyclonal Antibody
TA328624

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Melanocortin Receptor 1

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HAQGIARLHKRQRPVH, corresponding to amino acid residues 217-232 of human MC1R. 3rd intracellular loop.
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA312351

USD 345.00

In Stock

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.
FZD3 Rabbit Polyclonal Antibody
TA314708

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD3.
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA314727

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD6.
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA314704

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD5 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA312352

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD4 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD4.
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA356128

USD 360.00

5 Days

FZD10 Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH