Antibodies

View as table Download

Rabbit Polyclonal LPIN1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LPIN1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human LPIN1.

Rabbit Polyclonal Anti-LPIN1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPIN1 Antibody: synthetic peptide directed towards the N terminal of human LPIN1. Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Lipin 1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Lipin 1