Antibodies

Jump to Filters
View as table Download
iASPP (PPP1R13L) Rabbit Polyclonal Antibody
TA331182

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP1R13L Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL