iASPP (PPP1R13L) Rabbit Polyclonal Antibody

CAT#: TA331182

Rabbit Polyclonal Anti-PPP1R13L Antibody

Product Images

WB Suggested Anti-PPP1R13L Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

• 

  Lanes: 1. 30 ug MiaPaca-2 cell lysate; 2. 30 ug Panc-1 cell lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Goat anti-Rabbit HRP; Secondary Antibody Dilution: ; 1:4000; Gene Name: ; PPP1R13L; Submitted by: ; Dr. Crissy Dudgeon, Ph.D., C

• 

  Sample Type : Human lung adenocarcinoma cell line A549Primary Antibody Dilution : 1:100Secondary Antibody : Goat anti-rabbit AlexaFluor 488Secondary Antibody Dilution : 1:400Color/Signal Descriptions : PPP1R13L: Green DAPI:BlueGene Name : PPP1R13L Submitt

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: protein phosphatase 1 regulatory subunit 13 like
• Database Link:
  NP_006654
  Entrez Gene 10848 Human
  UniProt ID Q8WUF5
• Background: IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53), whereas ASPP1 and ASPP2 are activators of p53.IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: IASPP; NKIP1; RAI; RAI4
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Transcription Factors