Germany
Japan
United Kingdom
China
Antibodies
Download
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
USD 380.00
In Stock
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Active filters
Applications
- IHC
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- MUC1 (5)
- BAX (4)
- CLDN7 (4)
- ERBB3 (4)
- MME (4)
- NTRK1 (4)
- SPAG4 (4)
- TRPC6 (4)
- ACVR1C (3)
- ADRB3 (3)
- APLNR (3)
- APP (3)
- AQP3 (3)
- BSG (3)
- CCR6 (3)
- CLDN5 (3)
- COX4I1 (3)
- CXCR4 (3)
- EIF2AK3 (3)
- FASLG (3)
- FGFR2 (3)
- FZD8 (3)
- GJB6 (3)
- GRIK1 (3)
- GRIN1 (3)
- GRM3 (3)
- GRM4 (3)
- IGF2R (3)
- OMG (3)
- ORAI1 (3)
- PTPRJ (3)
- SCARB1 (3)
- SCN11A (3)
- SDCBP (3)
- SLC8A3 (3)
- STEAP4 (3)
- TLR8 (3)
- TNFSF13 (3)
- TRPC3 (3)
- TRPM7 (3)
- VTCN1 (3)
- A4GNT (2)
- ABCB5 (2)
- ABCB6 (2)
- ABHD12 (2)
- ABI3BP (2)
- ACE2 (2)
- ACVR1B (2)
- ADAM2 (2)
- ADAM20 (2)
- ADAM7 (2)
- ADCY4 (2)
- ADCY5 (2)
- ADGRB1 (2)
- ADIPOR2 (2)
- ADRA1A (2)
- AKAP1 (2)
- ALDH3A2 (2)
- ALDH6A1 (2)
- ALG12 (2)
- ALG9 (2)
- APLP1 (2)
- APOB (2)
- APOL2 (2)
- AQP1 (2)
- AQP2 (2)
- AQP5 (2)
- AQP8 (2)
- ARMCX1 (2)
- ARMCX3 (2)
- ARSK (2)
- ASPH (2)
- ATP1A1 (2)
- AUP1 (2)
- BAI2 (2)
- BDKRB1 (2)
- BDNF (2)
- BMPR2 (2)
- BNIP1 (2)
- BNIP3L (2)
- BPIFB2 (2)
- CA4 (2)
- CADM4 (2)
- CALCRL (2)
- CAV3 (2)
- CCR3 (2)
- CCR5 (2)
- CD151 (2)
- CD44 (2)
- CD93 (2)
- CDH1 (2)
- CDH23 (2)
- CDH8 (2)
- CEACAM3 (2)
- CELSR2 (2)
- CFTR (2)
- CLDN1 (2)
- CLDN10 (2)
- CLDN19 (2)
- CLEC4C (2)
Reactivities
- Human (1293)
- Mouse (956)
- Rat (794)
- Monkey (22)
- Gorilla (16)
- Dog (14)
- Bovine (12)
- Pig (10)
- Gibbon (9)
- Chicken (6)
- Hamster (6)
- Rabbit (6)
- Chimpanzee (5)
- Horse (5)
- Orang-Utan (4)
- Cow (3)
- Guinea Pig (3)
- Rhesus Monkey (3)
- Zebrafish (3)
- Bat (2)
- X. tropicalis (2)
- Xenopus (2)
- Goat (1)
- Opossum (1)
- Primate (1)
- Pufferfish (1)
- Sheep (1)
Antibody Hosts
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (123)
- Cytokine-cytokine receptor interaction (104)
- Metabolic pathways (74)
- Pathways in cancer (69)
- Calcium signaling pathway (64)
- Cell adhesion molecules (CAMs) (62)
- Endocytosis (47)
- Alzheimer's disease (44)
- MAPK signaling pathway (42)
- Leukocyte transendothelial migration (36)
- Hematopoietic cell lineage (35)
- Axon guidance (31)
- Regulation of actin cytoskeleton (30)
- Colorectal cancer (28)
- Melanogenesis (27)
- Jak-STAT signaling pathway (26)
- Chemokine signaling pathway (25)
- Adherens junction (24)
- Wnt signaling pathway (24)
- ABC transporters (23)
- Tight junction (23)
- Focal adhesion (22)
- Huntington's disease (22)
- Vascular smooth muscle contraction (22)
- Toll-like receptor signaling pathway (21)
- Apoptosis (20)
- Dilated cardiomyopathy (20)
- Natural killer cell mediated cytotoxicity (19)
- Neurotrophin signaling pathway (19)
- Amyotrophic lateral sclerosis (ALS) (18)
- Basal cell carcinoma (17)
- Gap junction (17)
- TGF-beta signaling pathway (17)
- Hypertrophic cardiomyopathy (HCM) (15)
- Long-term potentiation (15)
- Pancreatic cancer (15)
- ECM-receptor interaction (14)
- PPAR signaling pathway (14)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (13)
- Drug metabolism - cytochrome P450 (13)
- ErbB signaling pathway (13)
- GnRH signaling pathway (13)
- SNARE interactions in vesicular transport (13)
- Adipocytokine signaling pathway (12)
- Parkinson's disease (12)
- Retinol metabolism (12)
- Long-term depression (11)
- Metabolism of xenobiotics by cytochrome P450 (11)
- Prostate cancer (11)
- Renin-angiotensin system (11)
- Taste transduction (11)
- Type II diabetes mellitus (11)
- Cardiac muscle contraction (10)
- Chronic myeloid leukemia (10)
- Complement and coagulation cascades (10)
- Hedgehog signaling pathway (10)
- Melanoma (10)
- Oocyte meiosis (10)
- Oxidative phosphorylation (10)
- Purine metabolism (10)
- p53 signaling pathway (10)
- Graft-versus-host disease (9)
- N-Glycan biosynthesis (9)
- Notch signaling pathway (9)
- Pathogenic Escherichia coli infection (9)
- Arachidonic acid metabolism (8)
- Bladder cancer (8)
- Lysosome (8)
- Systemic lupus erythematosus (8)
- Viral myocarditis (8)
- Allograft rejection (7)
- Androgen and estrogen metabolism (7)
- Antigen processing and presentation (7)
- Autoimmune thyroid disease (7)
- Linoleic acid metabolism (7)
- Progesterone-mediated oocyte maturation (7)
- Thyroid cancer (7)
- Type I diabetes mellitus (7)
- Biosynthesis of unsaturated fatty acids (6)
- Endometrial cancer (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Fatty acid metabolism (6)
- Primary immunodeficiency (6)
- B cell receptor signaling pathway (5)
- Glioma (5)
- Glycerolipid metabolism (5)
- Non-small cell lung cancer (5)
- Prion diseases (5)
- Renal cell carcinoma (5)
- Tryptophan metabolism (5)
- Vibrio cholerae infection (5)
- Ascorbate and aldarate metabolism (4)
- Chondroitin sulfate biosynthesis (4)
- Drug metabolism - other enzymes (4)
- Fc gamma R-mediated phagocytosis (4)
- Glutathione metabolism (4)
- Porphyrin and chlorophyll metabolism (4)
- Primary bile acid biosynthesis (4)
- Propanoate metabolism (4)
- Riboflavin metabolism (4)
- Small cell lung cancer (4)
- Starch and sucrose metabolism (4)
- Steroid biosynthesis (4)
- T cell receptor signaling pathway (4)
- Valine (4)
- leucine and isoleucine degradation (4)
- Asthma (3)
- C21-Steroid hormone metabolism (3)
- Glycerophospholipid metabolism (3)
- Phosphatidylinositol signaling system (3)
- RIG-I-like receptor signaling pathway (3)
- Sphingolipid metabolism (3)
- Tyrosine metabolism (3)
- Acute myeloid leukemia (2)
- Arginine and proline metabolism (2)
- Butanoate metabolism (2)
- Caffeine metabolism (2)
- Cytosolic DNA-sensing pathway (2)
- Dorso-ventral axis formation (2)
- Ether lipid metabolism (2)
- Fc epsilon RI signaling pathway (2)
- Glycolysis / Gluconeogenesis (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Heparan sulfate biosynthesis (2)
- Histidine metabolism (2)
- Inositol phosphate metabolism (2)
- Insulin signaling pathway (2)
- Limonene and pinene degradation (2)
- Lysine degradation (2)
- NOD-like receptor signaling pathway (2)
- Nicotinate and nicotinamide metabolism (2)
- Nitrogen metabolism (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Pyrimidine metabolism (2)
- Pyruvate metabolism (2)
- Ubiquitin mediated proteolysis (2)
- beta-Alanine metabolism (2)
- Base excision repair (1)
- Cell cycle (1)
- Cyanoamino acid metabolism (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Keratan sulfate biosynthesis (1)
- Maturity onset diabetes of the young (1)
- O-Glycan biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- Olfactory transduction (1)
- Selenoamino acid metabolism (1)
- Sulfur metabolism (1)
- Taurine and hypotaurine metabolism (1)
- Terpenoid backbone biosynthesis (1)
- VEGF signaling pathway (1)