Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 206 results

Page 1 of 5

(reset)

BRCA1 Rabbit Polyclonal Antibody

TA310042

USD 465.00

In Stock

Rabbit anti-BRCA1 polyclonal antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).

1 / 2

2 / 2

Previous Next

Cullin 3 (CUL3) Rabbit Polyclonal Antibody

TA349289

USD 380.00

In Stock

Rabbit Polyclonal Anti-CUL3 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CUL3

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BRCA1 Rabbit Polyclonal Antibody

TA349262

USD 380.00

In Stock

Rabbit Polyclonal Anti-BRCA1 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human BRCA1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cullin 7 (CUL7) Rabbit Polyclonal Antibody

TA349290

USD 380.00

In Stock

Rabbit Polyclonal Anti-CUL7 Antibody

Applications	IHC
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CUL7

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

cIAP1 (BIRC2) Rabbit Monoclonal Antibody [Clone ID: EPR4673]

TA307562

USD 512.00

In Stock

Rabbit monoclonal antibody against cIAP1(clone EPR4673)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

MID1 Rabbit Polyclonal Antibody

TA311672

USD 345.00

In Stock

Rabbit polyclonal anti-TRI18/MID1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TRI18.

1 / 3

2 / 3

3 / 3

Previous Next

XIAP Rabbit Polyclonal Antibody

TA306170

USD 430.00

In Stock

Rabbit Polyclonal XIAP Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PML Protein (PML) Rabbit Polyclonal Antibody

TA314354

USD 345.00

In Stock

Rabbit polyclonal anti-PML antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human PML.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SKP1 Rabbit Polyclonal Antibody

TA322454

USD 345.00

In Stock

Anti-SKP1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to N terminal 163 amino acids of human S-phase kinase-associated protein 1

1 / 2

2 / 2

Previous Next

KEAP1 Rabbit Polyclonal Antibody

TA590238

USD 409.00

In Stock

Rabbit Polyclonal KEAP1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Cullin 4B (CUL4B) Rabbit Polyclonal Antibody

TA590752

USD 409.00

In Stock

Rabbit Polyclonal CUL4B Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

MDM2 Rabbit Polyclonal Antibody

TA302211

USD 450.00

In Stock

Rabbit Polyclonal Antibody against MDM2 (C-term)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MDM2 Rabbit Polyclonal Antibody

TA311995

USD 345.00

In Stock

Rabbit polyclonal anti-MDM2 antibody

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human MDM2.

1 / 3

2 / 3

3 / 3

Previous Next

Cullin 1 (CUL1) Rabbit Polyclonal Antibody

TA313012

USD 345.00

In Stock

Rabbit polyclonal anti-Cullin 1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Cullin 1.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cullin 2 (CUL2) Rabbit Polyclonal Antibody

TA314751

USD 345.00

In Stock

Rabbit polyclonal anti-Cullin 2 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Cullin 2.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PIAS3 Rabbit Polyclonal Antibody

TA319815

USD 430.00

In Stock

Rabbit Polyclonal PIAS3 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	PIAS3 antibody was raised against a 12 amino acid synthetic peptide near the carboxy terminus of human PIAS3.

1 / 2

2 / 2

Previous Next

Apc6 (CDC16) Rabbit Polyclonal Antibody

TA311639

USD 345.00

In Stock

Rabbit polyclonal CDC16/APC6 (Ab-560) antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P).

1 / 2

2 / 2

Previous Next

MEKK1 (MAP3K1) Rabbit Polyclonal Antibody

TA314186

USD 345.00

In Stock

Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

EDD (UBR5) Rabbit Polyclonal Antibody

TA315471

USD 345.00

In Stock

Rabbit polyclonal anti-UBR5 / EDD antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human EDD.

1 / 3

2 / 3

3 / 3

Previous Next

FBXW7 Mouse Monoclonal Antibody [Clone ID: 3D1]

TA316739

USD 480.00

In Stock

FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

TRIM32 Rabbit Polyclonal Antibody

TA323256

USD 345.00

In Stock

Anti-TRIM32 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human tripartite motif containing 32

1 / 2

2 / 2

Previous Next

Parkin (PARK2) Rabbit Polyclonal Antibody

TA326251

USD 345.00

In Stock

Rabbit polyclonal Parkin antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Parkin antibody.

1 / 2

2 / 2

Previous Next

PIAS1 Rabbit Polyclonal Antibody

TA326261

USD 345.00

In Stock

Rabbit polyclonal PIAS1 antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human PIAS1.

1 / 2

2 / 2

Previous Next

PIAS3 Rabbit Polyclonal Antibody

TA326269

USD 345.00

In Stock

Rabbit polyclonal PIAS3 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human PIAS3.

1 / 2

2 / 2

Previous Next

TRIM32 Rabbit Polyclonal Antibody

TA329387

USD 375.00

In Stock

Rabbit Polyclonal anti-TRIM32 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE

1 / 2

2 / 2

Previous Next

ROC2 (RNF7) Rabbit Polyclonal Antibody

TA350357

USD 345.00

In Stock

Rabbit Polyclonal Anti-RNF7 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human RNF7

1 / 2

2 / 2

Previous Next

UBE2S Rabbit Polyclonal Antibody

TA590247

USD 409.00

In Stock

Rabbit Polyclonal UBE2S Antibody

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501).

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ITCH Rabbit Polyclonal Antibody

TA312425

USD 345.00

In Stock

Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N).
Modifications	Phospho-specific

BRCA1 Rabbit Polyclonal Antibody

TA313518

USD 345.00

In Stock

Rabbit polyclonal BRCA1 (Ab-1423) antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).

Apc1 (ANAPC1) Rabbit Polyclonal Antibody

TA315737

USD 345.00

In Stock

Rabbit polyclonal anti-APC1 antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human APC1.

UBA6 Mouse Monoclonal Antibody [Clone ID: 1D11]

TA317480

USD 480.00

In Stock

UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

KEAP1 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

CF502059

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

UBOX5 Mouse Monoclonal Antibody [Clone ID: OTI8D5]

CF502809

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBOX5 mouse monoclonal antibody, clone OTI8D5 (formerly 8D5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

SOCS3 Mouse Monoclonal Antibody [Clone ID: OTI3D3]

CF502991

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SOCS3 mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

UBE2E3 Mouse Monoclonal Antibody [Clone ID: OTI1B4]

CF504682

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2E3 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3C11]

CF504969

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3E6]

CF504970

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI1F6]

CF504975

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D1]

CF504988

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

CF505006

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody,clone OTI3D5

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

CF505029

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

CF505238

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI5F1]

CF505239

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI1D7]

CF505258

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI1B10]

CF505259

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI4E12]

CF505260

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI4E12 (formerly 4E12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]

CF505261

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

CF505262

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI4D6]

CF505263

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

UBE2G2 Mouse Monoclonal Antibody [Clone ID: OTI4A12]

CF505286

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBE2G2 mouse monoclonal antibody, clone OTI4A12 (formerly 4A12)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 50 of 206 results

Page 1 of 5