Antibodies

View as table Download

Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal DNMT3A Antibody (64B1446)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

BHMT (391-402) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Hamster, Human, Monkey, Rat
Immunogen Synthetic peptide from C-term of human BHMT

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated