Antibodies

View as table Download

Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719)

Rabbit Polyclonal Anti-KYNU Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated

KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

KYNU mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".