L Kynurenine Hydrolase (KYNU) Rabbit Polyclonal Antibody

CAT#: TA338980

Rabbit Polyclonal Anti-KYNU Antibody

Product Images

WB Suggested Anti-KYNU Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate.KYNU is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: kynureninase
• Database Link:
  NP_003928
  Entrez Gene 8942 Human
  UniProt ID Q16719
• Background: Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
• Synonyms: KYNUU
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Yeast: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Protease
• Protein Pathways: Metabolic pathways, Tryptophan metabolism