Rabbit Polyclonal anti-STAT6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
Rabbit anti STAT5 (pY694) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- with phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Rabbit anti STAT5 (Paired Y694) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- without phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Rabbit anti-STAT6 (Phospho-Thr645) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of threonine 645 (P-A-TP-I-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BCL-XL antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human BCL-XL. |
Rabbit polyclonal BCL-XL (Thr115) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BCL-XL around the phosphorylation site of threonine 115 (H-I-TP-P-G). |
| Modifications | Phospho-specific |
Phospho-STAT6-T645 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T645 of human STAT6 |
| Modifications | Phospho-specific |
Rabbit anti Bcl-X Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human BCL-X protein. This sequence is identical in human and mouse. |
Anti-CSF3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 50-64 amino acids of human colony stimulating factor 3 (granulocyte) |
Anti-STAT5B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B |
Anti-AKT1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 10-224 amino acids of human V-akt murine thymoma viral oncogene homolog 1 |
Anti-CSF3R Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 470-484 amino acids of human colony stimulating factor 3 receptor (granulocyte) |
Anti-AKT3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 450-468 amino acids of human v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) |
Anti-AKT3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 450-468 amino acids of human v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) |
Rabbit Polyclonal Anti-OSM Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human OSM |
USD 345.00
In Stock
Germany
Japan
United Kingdom
China
