Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI |
Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human: Thr246, Mouse: Thr247, Rat: Thr247 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K). |
| Modifications | Phospho-specific |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNN2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Immunogen | KCNN2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human KCNN2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Hamster, Panda, Dog, Horse, Guinea pig (94%); Marmoset, Rat, Elephant, Bat (89%); Mouse, Pig (83%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Human, Monkey, Mouse, Rat |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Bat (100%); Elephant, Dog, Horse, Rabbit, Guinea pig (94%); Hamster (82%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%). |
Mouse Monoclonal Anti-Kv1.2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-Kv1.6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNJ3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | KCNJ3 / GIRK1 antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNJ3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Pig, Guinea pig (100%); Turkey, Chicken, Platypus (94%); Bat (88%); Xenopus, Stickleback (81%). |
Rabbit Polyclonal Anti-KCNA3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | KCNA3 / Kv1.3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Mouse, Rat (88%). |
Rabbit Polyclonal Anti-KCNA3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | KCNA3 / Kv1.3 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Rabbit, Pig (100%); Bovine, Opossum (94%); Lizard (88%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-KCNN4 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KCNN4 / KCa3.1 antibody was raised against synthetic 14 amino acid peptide from N-Terminus of human KCNN4. Percent identity with other species by BLAST analysis: Human, Gorilla, Bovine (100%); Marmoset, Panda, Dog, Rabbit, Pig (93%); Mouse, Rat, Guinea pig (86%). |
Rabbit Polyclonal Anti-KCNN4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | KCNN4 / KCa3.1 antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human KCNN4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Rabbit, Pig, Guinea pig (100%); Monkey, Horse, Platypus (93%). |
Anti-KCNA1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) |
Anti-KCNH8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNH8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2 |
Anti-KCNH3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 95-144 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 3 |
Anti-KCNC1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1 |
Rabbit Polyclonal Anti-KCNJ11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNJ11 |
Rabbit Polyclonal Anti-KCNK1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KCNK1 |
Rabbit Polyclonal Anti-KCNB1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNB1 |
Rabbit Polyclonal Anti-KCNA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNA7 |
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNG1 |
Rabbit Polyclonal Anti-KCNG2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNG2 |
Rabbit Polyclonal Anti-KCNG4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNG4 |
Rabbit Polyclonal Anti-KCNK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNK3 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
KCNJ3 (GIRK1 ) mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
