Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLCG1 (Tyr771) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-YP-G-A) |
| Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit polyclonal PLC-beta (Ser1105) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLC-β around the phosphorylation site of serine 1105 (N-N-SP-I-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DGKH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW |
USD 300.00
2 Weeks
PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y). |
USD 230.00
2 Weeks
PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y). |
SHIP (INPP5D) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to C-terminal of human SHIP-1 |
Goat Polyclonal Antibody against PIK3CA
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQWLKDKNKGEIYD, from the internal region of the protein sequence according to NP_006209.2. |
Goat Anti-PIK3C2A Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TVKWYQLTAATYL, from the C Terminus of the protein sequence according to NP_002636.2. |
Rabbit polyclonal anti-CALML5 (CABP7) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CALML5. |
Rabbit polyclonal anti-PIP5K antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PIP5K. |
INPP5J / PIB5PA Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Pig |
| Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 19 amino acid peptide from internal region of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Elephant, Horse, Pig (100%); Gibbon, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Panda, Rabbit (95%); Bat, Platypus (89%). |
INPP5J / PIB5PA Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 15 amino acid peptide from N-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (87%); Marmoset (80%). |
Phospho-PLCG2-Y1217 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1217 of human PLCG2 |
| Modifications | Phospho-specific |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) PIK3CA mouse monoclonal antibody, clone OTI7A7 (formerly 7A7)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Active filters
Category
- Antibodies
Applications
- IHC
Pathways
- Phosphatidylinositol signaling system
Filter by
Target Symbol
- PIK3C2A (72)
- PIK3CG (54)
- PIK3R5 (37)
- PIK3CD (28)
- PIK3CA (23)
- PIKFYVE (12)
- DGKA (10)
- PIK3C2B (10)
- PIK3R1 (9)
- PRKCA (9)
- PTEN (8)
- DGKZ (7)
- PIP4K2A (7)
- ITPK1 (5)
- PLCB3 (4)
- PIB5PA (3)
- PLCG1 (3)
- DGKH (2)
- INPP5B (2)
- ITPR2 (2)
- PIK3C3 (2)
- PIK3R3 (2)
- PRKCB (2)
- CALM1 (1)
- CALM2 (1)
- CALML5 (1)
- DGKB (1)
- DGKD (1)
- DGKE (1)
- DGKI (1)
- INPP1 (1)
- INPP4A (1)
- INPP5D (1)
- INPPL1 (1)
- IPPK (1)
- ITPR1 (1)
- ITPR3 (1)
- OCRL (1)
- PI4KB (1)
- PIK3CB (1)
- PIK3R2 (1)
- PIP5K1A (1)
- PIP5K1B (1)
- PIP5K1C (1)
- PLCB1 (1)
- PLCB2 (1)
- PLCG2 (1)
- PLCZ1 (1)
- PRKCG (1)