Antibodies

View as table Download

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AGER

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: RIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGG

Rabbit polyclonal AGER Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This AGER antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human AGER.

Rabbit polyclonal RAGE (AGER) Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RAGE (AGER) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 348-378 amino acids from the C-terminal region of human RAGE (AGER).

AGER rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AGER

Recombinant Anti-RAGE (Clone 2A11)

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-RAGE (Clone 2A11)

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.