Antibodies

Jump to Filters
View as table Download
TJP1
AB0054-200

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.
beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody
AP51124PU-N

USD 450.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.
Myosin Light Chain 2 (MYL2) Rabbit Polyclonal Antibody
TA309976

USD 370.00

2 Weeks

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications Phospho-specific
AKT1 Rabbit Polyclonal Antibody
TA313266

USD 345.00

4 Weeks

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific
PKC alpha (PRKCA) (pan) Rabbit Polyclonal Antibody
AP06566PU-N

USD 407.00

2 Weeks

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.
PKC zeta (PRKCZ) Rabbit Polyclonal Antibody
TA312044

USD 345.00

4 Weeks

Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C).
Modifications Phospho-specific
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313140

USD 345.00

In Stock

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA334203

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH