Antibodies

Jump to Filters
View as table Download
TAPA1 (CD81) Rabbit Polyclonal Antibody
TA343281

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
TAPA1 (CD81) Mouse Monoclonal Antibody [Clone ID: M38]
AM26031PU-N

USD 240.00

2 Weeks

TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified

Applications FC, FN, IF, IHC, IP, WB
Reactivities Feline, Human, Rabbit