Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
Interferon beta (IFNB1) Rabbit Polyclonal Antibody
TA306437

USD 430.00

2 Weeks

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.
ISG15 Rabbit Polyclonal Antibody
TA342596

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK