Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 34 of 34 results

(reset)

beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody

AP51124PU-N

USD 450.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

1 / 3

2 / 3

3 / 3

Previous Next

Myosin Light Chain 2 (MYL2) Rabbit Polyclonal Antibody

TA309976

USD 370.00

2 Weeks

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

CD31 (PECAM1) Rabbit Polyclonal Antibody

TA313338

USD 345.00

4 Weeks

Rabbit polyclonal PECAM-1 (Ab-713) antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody

PP1067P1

USD 260.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

1 / 3

2 / 3

3 / 3

Previous Next

SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody

PP1067P2

USD 355.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)

1 / 3

2 / 3

3 / 3

Previous Next

PI 3 Kinase p85 alpha (PIK3R1) Rabbit Polyclonal Antibody

AP20772PU-N

USD 370.00

2 Weeks

PI 3 Kinase p85 alpha (PIK3R1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide, corresponding to amino acids 470-510 of Human PI3K p85α.

1 / 2

2 / 2

Previous Next

RAC1 Rabbit Polyclonal Antibody

TA308948

USD 415.00

In Stock

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

1 / 3

2 / 3

3 / 3

Previous Next

VE Cadherin (CDH5) Rabbit Polyclonal Antibody

TA313597

USD 345.00

4 Weeks

Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

PKC alpha (PRKCA) (pan) Rabbit Polyclonal Antibody

AP06566PU-N

USD 407.00

2 Weeks

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.

1 / 2

2 / 2

Previous Next

PYK2 (PTK2B) Rabbit Polyclonal Antibody

TA321623

USD 345.00

4 Weeks

Anti-PTK2B Rabbit Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide sequence around aa.400~404 (D-I-Y-A-E) derived from Human Pyk2.

1 / 3

2 / 3

3 / 3

Previous Next

PI 3 Kinase catalytic subunit alpha (PIK3CA) Rabbit Polyclonal Antibody

TA302178

USD 450.00

2 Weeks

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.

1 / 3

2 / 3

3 / 3

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

TA313140

USD 345.00

In Stock

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

MMP2 (C-term) Rabbit Polyclonal Antibody

AP23331PU-N

USD 405.00

2 Weeks

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2

1 / 2

2 / 2

Previous Next

Vinculin (VCL) Rabbit Polyclonal Antibody

TA326660

USD 430.00

5 Days

Rabbit Polyclonal Vinculin Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Vinculin antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Vinculin.

1 / 3

2 / 3

3 / 3

Previous Next

Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody

TA334203

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

1 / 2

2 / 2

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA500072

USD 379.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA500072S

USD 159.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: OTI8A9]

TA500121

USD 379.00

In Stock

Anti-PECAM1 (CD31) mouse monoclonal antibody, clone OTI8A9 (formerly 8A9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

SHC (SHC1) Mouse Monoclonal Antibody [Clone ID: OTI3A1]

TA501056

USD 379.00

In Stock

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SHC (SHC1) Mouse Monoclonal Antibody [Clone ID: OTI3A1]

TA501056S

USD 159.00

2 Days

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12H7]

TA502409

USD 379.00

In Stock

CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12H7]

TA502409S

USD 159.00

In Stock

CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

FAK (PTK2) Mouse Monoclonal Antibody [Clone ID: OTI4A8]

TA506161

USD 379.00

In Stock

PTK2 (FAK) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ICAM1 Mouse Monoclonal Antibody [Clone ID: OTI2H4]

TA506870

USD 379.00

In Stock

ICAM1 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ICAM1 Mouse Monoclonal Antibody [Clone ID: OTI2H4]

TA506870S

USD 159.00

2 Days

ICAM1 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD99 Mouse Monoclonal Antibody [Clone ID: OTI5C1]

TA800788

USD 379.00

In Stock

CD99 mouse monoclonal antibody, clone OTI5C1 (formerly 5C1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CD99 Mouse Monoclonal Antibody [Clone ID: OTI5C1]

TA800788S

USD 159.00

2 Days

CD99 mouse monoclonal antibody, clone OTI5C1 (formerly 5C1)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

VE Cadherin (CDH5) Mouse Monoclonal Antibody [Clone ID: OTI1F4]

TA804746

USD 379.00

In Stock

CDH5 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

TA806846

USD 379.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

TA806846S

USD 159.00

2 Days

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: UMAB15]

UM500015

USD 468.00

In Stock

Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15

Applications	10k-ChIP, FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: UMAB29]

UM500029

USD 468.00

In Stock

PECAM1 mouse monoclonal antibody,clone UMAB29

Applications	10k-ChIP, FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: UMAB32]

UM500032

USD 468.00

In Stock

PECAM1 mouse monoclonal antibody,clone UMAB32

Applications	10k-ChIP, FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: UMAB32]

UM570032

USD 180.00

In Stock

PECAM1 mouse monoclonal antibody,clone UMAB32

Applications	10k-ChIP, FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 34 of 34 results