Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 20 of 20 results

(reset)

Caspase 3 (CASP3) Mouse Monoclonal Antibody [Clone ID: CPP32 4-1-18]

TA301776

USD 457.00

In Stock

Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NDUFAB1 Rabbit Polyclonal Antibody

TA308227

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Caspase 3 (CASP3) Rabbit Monoclonal Antibody [Clone ID: E87]

TA300366

USD 524.00

In Stock

Rabbit Monoclonal Antibody against CASP3 (Clone E87)

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

VMAT2 (SLC18A2) Rabbit Polyclonal Antibody

TA309861

USD 555.00

In Stock

Rabbit Polyclonal VMAT2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]

1 / 2

2 / 2

Previous Next

SDHD Rabbit Polyclonal Antibody

TA326622

USD 430.00

2 Weeks

Rabbit Polyclonal SDHD Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	SDHD antibody was raised against a 15 amino acid synthetic peptide near the center of human SDHD.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

TA312629

USD 345.00

In Stock

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Caspase 9.

1 / 2

2 / 2

Previous Next

VDAC1 Rabbit Polyclonal Antibody

TA308959

USD 415.00

In Stock

Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Dog
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TRPC1 Rabbit Polyclonal Antibody

TA328677

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPC1

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.

1 / 2

2 / 2

Previous Next

APAF1 Rabbit Polyclonal Antibody

TA313453

USD 345.00

In Stock

Rabbit polyclonal APAF-1-ALT antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human APAF-1-ALT.

1 / 2

2 / 2

Previous Next

Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

1 / 2

2 / 2

Previous Next

SDHB Rabbit Polyclonal Antibody

TA351639

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SDHB Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human SDHB

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI9E11]

TA500506

USD 379.00

In Stock

Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI9E11]

TA500506S

USD 159.00

In Stock

Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA504988

USD 379.00

In Stock

UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA504988S

USD 159.00

2 Days

UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA800089

USD 379.00

In Stock

UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA800089S

USD 159.00

2 Days

UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ATP5PO Mouse Monoclonal Antibody [Clone ID: OTI2E9]

TA804572

USD 379.00

In Stock

ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ATP5PO Mouse Monoclonal Antibody [Clone ID: OTI2E9]

TA804572S

USD 159.00

2 Days

ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SDHB Mouse Monoclonal Antibody [Clone ID: OTI3F5]

TA808102

USD 379.00

In Stock

SDHB mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

1 - 20 of 20 results