Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Monoclonal Antibody against CASP3 (Clone E87)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal VMAT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940] |
Rabbit Polyclonal SDHD Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SDHD antibody was raised against a 15 amino acid synthetic peptide near the center of human SDHD. |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796) |
Rabbit Polyclonal Anti-TRPC1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular. |
Rabbit polyclonal APAF-1-ALT antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human APAF-1-ALT. |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SDHB |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 159.00
2 Days
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SDHB mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |