Antibodies

Jump to Filters
View as table Download
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA309096

USD 415.00

2 Weeks

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH
Collagen I (COL1A1) Rabbit Polyclonal Antibody
R1038B

USD 540.00

2 Weeks

Collagen I (COL1A1) rabbit polyclonal antibody, Biotin

Applications ELISA, FC, IHC, IP, WB
Reactivities Bovine, Human, Mammalian, Mouse, Rat
Conjugation Biotin
Immunogen Collagen Type I from Human and Bovine placenta.
Collagen I (COL1A1) Rabbit Polyclonal Antibody
BP8028

USD 1,050.00

2 Weeks

Collagen I (COL1A1) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, R
Reactivities Human
Immunogen Purified Collagen type I from Human skin.
Collagen I (COL1A1) Rabbit Polyclonal Antibody
BP2156

USD 1,305.00

2 Weeks

Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free

Applications ELISA, IF, IHC
Reactivities Fish
Immunogen Collagen Type I extracted and purified from salmon fish skin.
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA342814

USD 375.00

5 Days

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS