Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MLNR Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MLNR |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GRIN2A |
Rabbit Polyclonal Anti-NPY4R Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NPY4R |
Rabbit Polyclonal Anti-S1PR2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human S1PR2 |
USD 345.00
In Stock
Rabbit Polyclonal Anti-GIPR Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GIPR |
Rabbit Polyclonal Anti-HTR2C Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HTR2C |
Rabbit Polyclonal Anti-CRHR1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CRHR1 |
USD 345.00
In Stock
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CALCRL |
Rabbit Polyclonal Anti-OPRD1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human OPRD1 |
Rabbit Polyclonal Anti-GABBR1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GABBR1 |
Rabbit Polyclonal Anti-GCGR Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GCGR |
Rabbit Polyclonal Anti-HRH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HRH1 |
Rabbit Polyclonal Anti-HRH3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HRH3 |
Rabbit Polyclonal Anti-KISS1R Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KISS1R |
Rabbit Polyclonal Anti-MCHR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MCHR1 |
Rabbit Polyclonal Anti-TRPV1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TRPV1 |
Rabbit Polyclonal Anti-OXTR Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human OXTR |
Rabbit Polyclonal Anti-OXTR Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human OXTR |
Rabbit Polyclonal Anti-P2RX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human P2RX3 |
Rabbit Polyclonal Anti-P2RX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human P2RX2 |
Rabbit Polyclonal Anti-VIPR2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human VIPR2 |
USD 345.00
In Stock
RXFP2 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Neuroactive ligand-receptor interaction
Filter by
Category
Target Symbol
- NR3C1 (10)
- GRIA2 (7)
- GRM1 (6)
- LEP (6)
- ADRA1B (5)
- GRIK1 (5)
- GRPR (5)
- HTR1F (5)
- HTR2B (5)
- KISS1R (5)
- NPY1R (5)
- S1PR1 (5)
- ADORA2A (4)
- ADRA1A (4)
- ADRB3 (4)
- APLNR (4)
- CCKAR (4)
- CHRM1 (4)
- CNR2 (4)
- CSH1 (4)
- F2R (4)
- GRIN1 (4)
- GRM4 (4)
- HCRTR1 (4)
- HTR2C (4)
- MAS1 (4)
- MC4R (4)
- P2RX2 (4)
- S1PR3 (4)
- S1PR5 (4)
- SSTR1 (4)
- ADORA2B (3)
- ADORA3 (3)
- ADRB2 (3)
- AGTR2 (3)
- BDKRB2 (3)
- CALCRL (3)
- DRD4 (3)
- DRD5 (3)
- FPR2 (3)
- FSHR (3)
- GABBR1 (3)
- GABRA3 (3)
- GIPR (3)
- GRIA3 (3)
- GRM3 (3)
- GRM7 (3)
- GRM8 (3)
- HRH3 (3)
- HTR5A (3)
- HTR7 (3)
- LPAR4 (3)
- MC1R (3)
- NMBR (3)
- NTSR1 (3)
- OPRM1 (3)
- P2RX1 (3)
- P2RY1 (3)
- P2RY2 (3)
- PRL (3)
- PTGER3 (3)
- SSTR2 (3)
- SSTR5 (3)
- TSHR (3)
- ADCYAP1R1 (2)
- AGTR1 (2)
- BDKRB1 (2)
- BRS3 (2)
- C3AR1 (2)
- CALCR (2)
- CHRM2 (2)
- CHRM5 (2)
- CYSLTR1 (2)
- DRD1 (2)
- DRD2 (2)
- DRD3 (2)
- EDNRB (2)
- F2 (2)
- F2RL2 (2)
- GABRA2 (2)
- GALR2 (2)
- GH1 (2)
- GLP1R (2)
- GLP2R (2)
- GLRA1 (2)
- GNRHR (2)
- GPR50 (2)
- GRIK4 (2)
- GRIK5 (2)
- GRIN2A (2)
- GRIN2C (2)
- GRIN2D (2)
- GRM2 (2)
- HRH1 (2)
- HTR1E (2)
- HTR2A (2)
- HTR4 (2)
- LEPR (2)
- LHB (2)
- LHCGR (2)
Reactivities
- Human (441)
- Mouse (271)
- Rat (269)
- Monkey (76)
- Dog (40)
- Gorilla (39)
- Bovine (35)
- Rabbit (33)
- Bat (30)
- Horse (29)
- Gibbon (27)
- Pig (24)
- Hamster (23)
- Chimpanzee (10)
- Guinea Pig (10)
- Chicken (6)
- Xenopus (6)
- Orang-Utan (5)
- Primate (5)
- Rhesus Monkey (5)
- Canine (2)
- Cow (2)
- Sheep (2)
- Goat (1)
- Macaque (1)
- Zebrafish (1)
Antibody Hosts
Modifications
Families
- Druggable Genome (449)
- Transmembrane (408)
- GPCR (317)
- Ion Channels: Glutamate Receptors (32)
- Secreted Protein (26)
- Transcription Factors (16)
- Ion Channels: Cys-loop Receptors (15)
- Nuclear Hormone Receptor (13)
- ES Cell Differentiation/IPS (10)
- Ion Channels: ATP Receptors (9)
- Protease (4)
- Ion Channels: Sodium (2)
- Ion Channels: Transient receptor potential (2)