Antibodies

View as table Download

Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Equine, Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal SR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121.

Rabbit Polyclonal beta-Arrestin 2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1.

Rabbit Polyclonal GRAIL/RNF128 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1.

Rabbit Polyclonal NFkB p65 NLS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Bovine, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody.

Rabbit Polyclonal TRBP Antibody

Applications IHC, WB
Reactivities Human, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 340-390 of human TRBP was used as the immunogen.

Rabbit Polyclonal CXCR7/RDC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1.

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.

Rabbit Polyclonal NLRX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody.

Rabbit Polyclonal FNBP1 Antibody

Applications IHC
Reactivities Equine, Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 575-643 of human FNBP1 (isoform CRA_a) was used as the immunogen. 597 614