Antibodies

Jump to Filters
View as table Download
Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody
TA341643

USD 310.00

5 Days

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Angiopoietin 1 (ANGPT1) (C-term) Rabbit Polyclonal Antibody
RA26000-100

USD 460.00

2 Weeks

Angiopoietin 1 (ANGPT1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Canine, Human, Rabbit, Rat
Conjugation Unconjugated
14-3-3 sigma (SFN) Rabbit Polyclonal Antibody
TA337133

USD 424.00

5 Days

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.