Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

HK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK1

Rabbit anti-HK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK2

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9

Rabbit polyclonal GCK Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL

Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224)

Rabbit polyclonal antibody to alpha 2A amylase(pancreatic) (amylase, alpha 2A (pancreatic))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 156 and 430 of alpha amylase 2A (pancreatic) (Uniprot ID#P04746)

Rabbit Polyclonal antibody to Trehalase (trehalase (brush-border membrane glycoprotein))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 7 and 285 of Trehalase (Uniprot ID#O43280)

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Dog, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%).

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%).

Anti-GCK Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4)

Anti-GCK Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4)

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3

Rabbit Polyclonal Anti-HK3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK3

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK2

Rabbit Polyclonal Anti-HK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK1

Rabbit Polyclonal Anti-AMY2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human AMY2A

Rabbit Polyclonal Anti-GCK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GCK

Rabbit Polyclonal Anti-GYS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GYS1

Rabbit Polyclonal Anti-GYS2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GYS2

Rabbit Polyclonal Anti-PYGL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PYGL

Rabbit Polyclonal Anti-PYGM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PYGM

Rabbit Polyclonal Anti-UGP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human UGP2

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT2B4

Rabbit Polyclonal Anti-AGL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGL

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UGT1A6