Antibodies

Jump to Filters
View as table Download
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA326936

USD 374.00

3 Weeks

ANXA1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANXA1
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA341644

USD 310.00

5 Days

Rabbit Polyclonal Anti-ANXA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD