Antibodies

View as table Download

Rabbit Polyclonal antibody to PARP3 (poly (ADP-ribose) polymerase family, member 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 63 and 370 of PARP3 (Uniprot ID#Q9Y6F1)

Rabbit polyclonal anti-PARP3 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PARP3.

Rabbit Polyclonal Anti-PARP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP3 antibody: synthetic peptide directed towards the C terminal of human PARP3. Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP

Rabbit Polyclonal Anti-PARP3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PARP3

Rabbit Polyclonal Anti-PARP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PARP3