Antibodies

Jump to Filters
View as table Download
Lysosomal acid lipase (LIPA) Rabbit Polyclonal Antibody
TA309730

USD 424.00

2 Weeks

Rabbit Polyclonal Lipase A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571]
Squalene Epoxidase (SQLE) Rabbit Polyclonal Antibody
TA346342

USD 475.00

5 Days

Rabbit Polyclonal Anti-SQLE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
CYP27B1 Rabbit Polyclonal Antibody
TA325091

USD 450.00

2 Weeks

Rabbit polyclonal CYP27B1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1.
Squalene Epoxidase (SQLE) (N-term) Rabbit Polyclonal Antibody
AP54036PU-N

USD 450.00

2 Weeks

Squalene Epoxidase (SQLE) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 67-97aa) of human Squalene epoxidase / SQLE
DHCR7 Rabbit Polyclonal Antibody
TA349889

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DHCR7
Seladin 1 (DHCR24) Rabbit Polyclonal Antibody
TA350394

USD 345.00

In Stock

Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DHCR24
Bile salt activated lipase (CEL) Rabbit Polyclonal Antibody
TA351006

USD 345.00

In Stock

Rabbit Polyclonal Anti-CEL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEL
C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody
TA351165

USD 345.00

In Stock

Rabbit Polyclonal Anti-MSMO1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MSMO1
TM7SF2 Rabbit Polyclonal Antibody
TA351818

USD 345.00

In Stock

Rabbit Polyclonal Anti-TM7SF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TM7SF2