Antibodies

Jump to Filters
View as table Download
DP1 (TFDP1) Rabbit Polyclonal Antibody
TA314614

USD 345.00

In Stock

Rabbit polyclonal anti-DP-1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DP-1.
DP1 (TFDP1) Rabbit Polyclonal Antibody
TA332684

USD 275.00

3 Weeks

Rabbit anti-TFDP1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TFDP1
DP1 (TFDP1) Rabbit Polyclonal Antibody
AP06089PU-N

USD 370.00

2 Weeks

DP1 (TFDP1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
DP1 (TFDP1) Rabbit Polyclonal Antibody
TA330086

USD 375.00

5 Days

Rabbit Polyclonal Anti-TFDP1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the N terminal of human TFDP1. Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN