DP1 (TFDP1) Rabbit Polyclonal Antibody

CAT#: TA330086

Rabbit Polyclonal Anti-TFDP1 Antibody

Product Images

WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

• 

  Human Intestine

• 

  Sample Type : HCT116; Primary Antibody Dilution: 4 ug/ml; Secondary Antibody : Anti-rabbit Alexa 546; Secondary Antibody Dilution: 2 ug/ml; Gene Name : TFDP1

Specifications

Product Data

• Applications: IF, IHC, WB
• Recommended Dilution: WB, IHC, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the N terminal of human TFDP1. Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: transcription factor Dp-1
• Database Link:
  NP_009042
  Entrez Gene 7027 Human
  UniProt ID Q14186
• Background: The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells.
• Synonyms: DILC; Dp-1; DP1; DRTF1
• Note: Immunogen sequence homology: Human: 100%; Bovine: 92%; Mouse: 92%; African clawed frog: 84%; Chicken: 84%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, TGF-beta signaling pathway