Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Equine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Equine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal SR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121. |
Rabbit Polyclonal beta-Arrestin 2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal GRAIL/RNF128 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Rabbit Polyclonal TRBP Antibody
Applications | IHC, WB |
Reactivities | Human, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 340-390 of human TRBP was used as the immunogen. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
Applications | IHC, WB |
Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal NLRX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody. |
Rabbit Polyclonal FNBP1 Antibody
Applications | IHC |
Reactivities | Equine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 575-643 of human FNBP1 (isoform CRA_a) was used as the immunogen. 597 614 |