Antibodies

Jump to Filters
View as table Download
RICTOR Rabbit Polyclonal Antibody
TA308477

USD 415.00

5 Days

Rabbit polyclonal antibody to RICTOR

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327)
RICTOR Goat Polyclonal Antibody
TA303018

USD 375.00

5 Days

Goat Polyclonal Antibody against RICTOR

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQPIVDTSAES, from the C Terminus of the protein sequence according to NP_689969.2.
RICTOR Rabbit Polyclonal Antibody
TA349591

USD 345.00

In Stock

Rabbit Polyclonal Anti-RICTOR Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR
RICTOR Rabbit Polyclonal Antibody
TA357866

USD 360.00

5 Days

RICTOR Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG
RICTOR Rabbit Polyclonal Antibody
TA368960

USD 380.00

4 Weeks

RICTOR rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR
RICTOR Rabbit Polyclonal Antibody
TA392544

USD 285.00

4 Weeks

Rictor (Phospho-Thr1135) polyclonal antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Rictor around the phosphorylation site of Threonine 1135.