Antibodies

View as table Download

Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Porcine, Rabbit
Conjugation Unconjugated

Rabbit anti-PRPF31 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRPF31

Rabbit Polyclonal Anti-PRPF19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK

Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI8H1 (formerly 8H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SF3A1 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HNRNPM mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HNRNPM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPM

SF3A1 mouse monoclonal antibody, clone OTI8H1 (formerly 8H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SF3A1 mouse monoclonal antibody, clone OTI8H1 (formerly 8H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SF3A1 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SF3A1 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SF3A1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SF3A1 mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SF3A1 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SF3A1 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HNRNPM mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNRNPM mouse monoclonal antibody, clone OTI3F3 (formerly 3F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HNRNPM mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNRNPM mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HNRNPM mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNRNPM mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HNRNPM mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNRNPM mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HNRNPM mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNRNPM mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI7F2 (formerly 7F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SRSF9 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".