PRP19 (PRPF19) Rabbit Polyclonal Antibody

CAT#: TA329843

Rabbit Polyclonal Anti-PRPF19 Antibody

Product Images

WB Suggested Anti-PRPF19 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

• 

  WB Suggested Anti-PRPF19 Antibody ; Positive Control: Lane 1: 5ug mouse brain cytoplasm Lane 2: 5ug mouse brain nucleus; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti rabbit - IR-dye; Secondry Antibody Dilution : 1:10,000; Submitted by: An

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: pre-mRNA processing factor 19
• Database Link:
  NP_055317
  Entrez Gene 28000 MouseEntrez Gene 27339 Human
  UniProt ID Q9UMS4
• Background: PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair. [supplied by OMIM]
• Synonyms: hPSO4; NMP200; PRP19; PSO4; SNEV; UBOX4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome, Ubiquitin mediated proteolysis