Germany
Japan
United Kingdom
China
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
Antibodies
View as table Download
Rabbit polyclonal RARA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA. |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
USD 465.00
In Stock
Anti-RARA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 200-419 amino acids of human retinoic acid receptor, alpha |
Anti-PPARD Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of human peroxisome proliferator-activated receptor delta |
USD 379.00
In Stock
USD 159.00
2 Days
RARA mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PPARD mouse monoclonal antibody,clone OTI4D10
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Families
- Nuclear Hormone Receptor
Pathways
- Acute myeloid leukemia