PPAR delta (PPARD) Rabbit Polyclonal Antibody

CAT#: TA343594

Rabbit Polyclonal Anti-PPARD Antibody

Product Images

WB Suggested Anti-PPARD Antibody Titration: 0.625 ug/ml; ELISA Titer: 1: 1562500; Positive Control: LN18 cell lysate; PPARD is strongly supported by BioGPS gene expression data to be expressed in Human LN18 cells

• 

  Rabbit Anti-PPARD antibody; Paraffin Embedded Tissue: Human Placenta cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: peroxisome proliferator activated receptor delta
• Database Link:
  NP_006229
  Entrez Gene 5467 Human
  UniProt ID Q03181
• Background: PPARD is a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biologic
• Synonyms: FAAR; NR1C2; NUC1; NUCI; NUCII; PPARB
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 75%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Pathways in cancer, PPAR signaling pathway, Wnt signaling pathway