Antibodies

View as table Download

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE

Rabbit polyclonal PLG Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG.

Carrier-free (BSA/glycerol-free) PLG mouse monoclonal antibody,clone OTI4F5

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-PLG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLG

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2