Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 56 results

Page 1 of 2

(reset)

Interferon gamma (IFNG) Rabbit Polyclonal Antibody

TA349348

USD 380.00

In Stock

Rabbit Polyclonal Anti-IFNG Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human IFNG

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TNFA.

1 / 2

2 / 2

Previous Next

CD40 Rabbit Polyclonal Antibody

TA311665

USD 345.00

4 Weeks

Rabbit polyclonal anti-CD40 antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human CD40.

1 / 3

2 / 3

3 / 3

Previous Next

C1QC Rabbit Polyclonal Antibody

TA324448

USD 450.00

5 Days

Rabbit polyclonal C1QC Antibody (Center)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL10 Rabbit Polyclonal Antibody

TA328225

USD 285.00

5 Days

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IL-10

1 / 3

2 / 3

3 / 3

Previous Next

Complement Component 6 (C6) Rabbit Polyclonal Antibody

TA313533

USD 345.00

4 Weeks

Rabbit polyclonal anti-C6 (complement component 6) antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human C6.

1 / 2

2 / 2

Previous Next

C1QC Rabbit Polyclonal Antibody

TA326232

USD 345.00

4 Weeks

Rabbit polyclonal C1QC antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human C1QC.

1 / 2

2 / 2

Previous Next

Interferon gamma (IFNG) Rabbit Polyclonal Antibody

TA328344

USD 285.00

5 Days

Anti-Human IFN-? Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IFN-γ

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Goat Polyclonal Antibody

TA328454

USD 285.00

5 Days

Anti-Human TNF-a Goat Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

Interferon gamma (IFNG) Rabbit Polyclonal Antibody

TA332378

USD 345.00

2 Weeks

Rabbit anti-IFNG Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein of human IFNG

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications	IHC, WB
Reactivities	Human, Primate
Conjugation	Unconjugated
Immunogen	The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA328455

USD 285.00

5 Days

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody

TA334645

USD 375.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA

1 / 2

2 / 2

Previous Next

Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody

TA334646

USD 375.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL

1 / 2

2 / 2

Previous Next

C1QB Rabbit Polyclonal Antibody

TA335243

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1QB Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

CF506510

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]

CF807163

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI1A7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

C2 Mouse Monoclonal Antibody [Clone ID: OTI12G10]

CF807188

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8B8]

CF807569

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8G5]

CF807572

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]

CF807575

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI9D8]

CF807682

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI9D8 (formerly 9D8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF807683

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI9F4]

CF807686

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI9F4 (formerly 9F4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]

CF807833

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA323618

USD 345.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CD16 (FCGR3A) Rabbit Polyclonal Antibody

TA350080

USD 345.00

In Stock

Rabbit Polyclonal Anti-FCGR3A Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human FCGR3A

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CD40 Rabbit Polyclonal Antibody

TA351052

USD 345.00

In Stock

Rabbit Polyclonal Anti-CD40 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human CD40

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

TA506510

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

TA506510S

USD 159.00

2 Days

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]

TA807163

USD 379.00

In Stock

C2 mouse monoclonal antibody,clone OTI1A7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

C2 Mouse Monoclonal Antibody [Clone ID: OTI1A7]

TA807163S

USD 159.00

2 Days

C2 mouse monoclonal antibody,clone OTI1A7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

C2 Mouse Monoclonal Antibody [Clone ID: OTI12G10]

TA807188

USD 379.00

In Stock

C2 mouse monoclonal antibody,clone OTI12G10

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

C2 Mouse Monoclonal Antibody [Clone ID: OTI12G10]

TA807188S

USD 159.00

In Stock

C2 mouse monoclonal antibody,clone OTI12G10

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8B8]

TA807569

USD 379.00

In Stock

CD40 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8B8]

TA807569S

USD 159.00

2 Days

CD40 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8G5]

TA807572

USD 379.00

In Stock

CD40 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8G5]

TA807572S

USD 159.00

2 Days

CD40 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]

TA807575

USD 379.00

In Stock

CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]

TA807575S

USD 159.00

2 Days

CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD40 Mouse Monoclonal Antibody [Clone ID: OTI9D8]

TA807682

USD 379.00

In Stock

CD40 mouse monoclonal antibody, clone OTI9D8 (formerly 9D8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI9D8]

TA807682S

USD 159.00

2 Days

CD40 mouse monoclonal antibody, clone OTI9D8 (formerly 9D8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD40 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

TA807683

USD 379.00

In Stock

CD40 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

TA807683S

USD 159.00

2 Days

CD40 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CD40 Mouse Monoclonal Antibody [Clone ID: OTI9F4]

TA807686

USD 379.00

In Stock

CD40 mouse monoclonal antibody, clone OTI9F4 (formerly 9F4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD40 Mouse Monoclonal Antibody [Clone ID: OTI9F4]

TA807686S

USD 159.00

2 Days

CD40 mouse monoclonal antibody, clone OTI9F4 (formerly 9F4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]

TA807833

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]

TA807833S

USD 159.00

In Stock

TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 50 of 56 results

Page 1 of 2