Rabbit polyclonal EAPII Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EAPII antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-272 amino acids from the C-terminal region of human EAPII. |
Rabbit Polyclonal Anti-TTRAP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TTRAP Antibody: synthetic peptide directed towards the middle region of human TTRAP. Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK |
Germany
Japan
United Kingdom
China
