ETS1 associated protein II (TDP2) Rabbit Polyclonal Antibody

CAT#: TA331907

Rabbit Polyclonal Anti-TTRAP Antibody

Product Images

Sample: 1. DT40 (5x105cells); 2. DT40 + rec. hTDP2 (5x105cells); 3. soluble HIS-hTDP2 (5x105cells); 4. pellet HIS-hTDP2 (5x105cells); Primary dilution: 1: 1000; Secondary Antibody: dakocytomation Goat anti-rabbit; Secondary dilution: 1: 5000; Image Submit

• 

  WB Suggested Anti-TTRAP Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysateTDP2 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TTRAP Antibody: synthetic peptide directed towards the middle region of human TTRAP. Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: tyrosyl-DNA phosphodiesterase 2
• Database Link:
  NP_057698
  Entrez Gene 51567 Human
  UniProt ID O95551
• Background: The TTRAP gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.
• Synonyms: AD022; dJ30M3.3; EAP2; EAPII; hTDP2; TTRAP
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors