Antibodies

Jump to Filters
View as table Download
TRIP13 Rabbit Polyclonal Antibody
TA339092

USD 310.00

5 Days

Rabbit Polyclonal Anti-TRIP13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the N terminal of human TRIP13. Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF
TRIP13 Mouse Monoclonal Antibody [Clone ID: OTI2F5]
CF809737

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TRIP13 mouse monoclonal antibody,clone OTI2F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TRIP13 Mouse Monoclonal Antibody [Clone ID: OTI2F5]
TA809737

USD 379.00

In Stock

TRIP13 mouse monoclonal antibody,clone OTI2F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TRIP13 Mouse Monoclonal Antibody [Clone ID: OTI2F5]
TA809737S

USD 159.00

2 Days

TRIP13 mouse monoclonal antibody,clone OTI2F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".