Rabbit polyclonal anti-CHST13 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST13. |
Rabbit polyclonal anti-CHST13 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST13. |
Rabbit Polyclonal antibody to SUOX (sulfite oxidase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 291 of SUOX (Uniprot ID#P51687) |
Rabbit polyclonal Anti-SULT1A1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SULT1A1 antibody: synthetic peptide directed towards the N terminal of human SULT1A1. Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT |
Carrier-free (BSA/glycerol-free) SULT1A1 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A1 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A1 mouse monoclonal antibody, clone OTI9B7 (formerly 9B7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SUOX mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SUOX mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody,clone OTI6H10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A3 mouse monoclonal antibody,clone OTI1E8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A3 mouse monoclonal antibody,clone OTI5E9
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A3 mouse monoclonal antibody,clone OTI3G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A3 mouse monoclonal antibody,clone OTI6A8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SULT1A3 mouse monoclonal antibody,clone OTI1C6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SULT1E1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 194 amino acids of human sulfotransferase family 1E, estrogen-preferring, member 1 |
Rabbit Polyclonal Anti-PAPSS1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAPSS1 |
Rabbit Polyclonal Anti-SULT2B1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SULT2B1 |
SULT1A1 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
SULT1A1 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SULT1A1 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SULT1A1 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SULT1A1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SULT1A1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SULT1A1 mouse monoclonal antibody, clone OTI9B7 (formerly 9B7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SULT1A1 mouse monoclonal antibody, clone OTI9B7 (formerly 9B7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SULT1A1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SULT1A1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SULT1A1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SULT1A1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SUOX mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SUOX mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SUOX mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SUOX mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PAPSS2 mouse monoclonal antibody,clone OTI6H10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAPSS2 mouse monoclonal antibody,clone OTI6H10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SULT1A3 mouse monoclonal antibody,clone OTI1E8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SULT1A3 mouse monoclonal antibody,clone OTI1E8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SULT1A3 mouse monoclonal antibody,clone OTI5E9
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |