Antibodies

Jump to Filters
View as table Download
RO60 Rabbit Polyclonal Antibody
TA345888

USD 410.00

5 Days

Rabbit Polyclonal Anti-TROVE2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
RO60 Rabbit Polyclonal Antibody
TA345889

USD 475.00

5 Days

Rabbit Polyclonal Anti-TROVE2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR
RO60 Rabbit Polyclonal Antibody
TA308022

USD 415.00

5 Days

Rabbit Polyclonal antibody to TROVE2 (TROVE domain family, member 2)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 178 and 459 of TROVE2 (Uniprot ID#P10155)