Antibodies

View as table Download

Rabbit Polyclonal Anti-IGF2BP1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal region of human IGF2BP1. Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP

Rabbit Polyclonal Anti-IGF2BP1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal of human IGF2BP1. Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT

Rabbit anti-IGF2BP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IGF2BP1

Anti-IGF2BP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 554-568 amino acids of Human insulin-like growth factor 2 mRNA binding protein 1

Anti-IGF2BP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 554-568 amino acids of Human insulin-like growth factor 2 mRNA binding protein 1

IGF2BP1 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated