Antibodies

View as table Download

Rabbit Polyclonal Anti-ILF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2. Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE

Carrier-free (BSA/glycerol-free) ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated

Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated

Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated