NUCB2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NUCB2 |
NUCB2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NUCB2 |
Rabbit Polyclonal Anti-NUCB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NUCB2 |
Rabbit Polyclonal Nucleobindin-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nucleobindin-2 antibody was raised against a 16 amino acid peptide near the center of human Nucleobindin-2 . |
Rabbit Polyclonal Anti-NUCB2 Antibody
Applications | IHC, WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
NUCB2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 321-420 of human NUCB2 (NP_005004.1). |
Modifications | Unmodified |