Rabbit Polyclonal Anti-TFPI2 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT |
Anti-TFPI2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 23-235 amino acids of human tissue factor pathway inhibitor 2 |
TFPI2 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
