Antibodies

Jump to Filters
View as table Download
ATP2A1 Rabbit Polyclonal Antibody
TA346377

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
ATP2A1 (522-613) Mouse Monoclonal Antibody [Clone ID: 1B11]
AM20402PU-N

USD 480.00

2 Weeks

ATP2A1 (522-613) mouse monoclonal antibody, clone 1B11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
ATP2A1 Rabbit Polyclonal Antibody
TA351399

USD 345.00

In Stock

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A1