Goat Polyclonal Antibody against MTR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Goat Polyclonal Antibody against MTR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Rabbit Monoclonal antibody against DHFR
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALDH1L1 mouse monoclonal antibody, clone 3E9, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Rabbit polyclonal MTHFD2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2. |
Rabbit Polyclonal Anti-MTHFD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD |
Rabbit Polyclonal Anti-MTHFD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG |
Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI6A10 (formerly 6A10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI10F12 (formerly 10F12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DHFR mouse monoclonal antibody, Clone 3A11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DHFR mouse monoclonal antibody, Clone 3A11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI6G7 (formerly 6G7), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI6G7 (formerly 6G7), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Biotin |
ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | HRP |
ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH1L1 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALDH1L1 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Biotin |